Protein coding transcript 97400

• Transcript: Ll_transcript_388223
• CDS coordinates: 348-809 (+)
• Peptide sequence: MPVNLFYKHNTAPGYLDKVGCVKDQNEMALFFNNQLKDRVIKLRTELPEAAITYVDVYAAKYGLISNAKNEGFDDPLKICCGYHVNDTHIWCGNLGTENGKDVFGAACEKPSASISWDGVHYAEAANHWVANHILNGSFTDPPTPITHSCYKH*
• ORF Type: complete

Annotations of Ll_transcript_388223

• Blastp: GDSL esterase/lipase At5g14450 from Arabidopsis with 60.13% of identity
• Blastx: GDSL esterase/lipase At5g14450 from Arabidopsis with 60.89% of identity
• Eggnog: GDSL esterase lipase(ENOG4111BJN)
• Kegg: Link to kegg annotations (AT5G14450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458884.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;