Transcript | Ll_transcript_389110 |
---|---|
CDS coordinates | 1-588 (+) |
Peptide sequence | EMLFQCGTFHIYALIYHFGTILLDLYFILIYETCACYRYNMVEQGLVKEPLFSFWLNRNPKEEQGGELVFGGVDPAHFKGEHTYVPVTRKGYWQFDMGDVLIGGKPTGYCAKDCSAIADSGTSLLAGPTAVITMINQAIGASGVASQECKAVVNQYGQTILDLLFTDAPPKKICSQIGLCTFDGTHGVRAGIESVV |
ORF Type | internal |
Blastp | Aspartic proteinase A1 from Arabidopsis with 80.38% of identity |
---|---|
Blastx | Aspartic proteinase A1 from Arabidopsis with 80.38% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AT1G11910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429923.1) |
Pfam | Eukaryotic aspartyl protease (PF00026.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer