Protein coding transcript 97459

• Transcript: Ll_transcript_389134
• CDS coordinates: 695-1282 (+)
• Peptide sequence: MRHFPINRYSMVQQGLVKEPVFSFWLNRKPEEEQGGEIVFGGVDPAHFKGEHTYVPVTRKGYWQFDMEDVLIGGKPTGYCAKDCSAIADSGTSLLAGPTAVITMINQAIGASGVASQECKSVVDKYGQTILDLLFSNAPPKKICSQIGLCTFDGTHGVSIGIESVVNKNEGQSSGGIHDATCSACEMAVVWMQNQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_389134

• Blastp: Aspartic proteinase A1 from Arabidopsis with 76.06% of identity
• Blastx: Aspartic proteinase A1 from Arabidopsis with 76.06% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT1G11910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426260.1)
• Pfam: Eukaryotic aspartyl protease (PF00026.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;