Transcript | Ll_transcript_513942 |
---|---|
CDS coordinates | 3-320 (+) |
Peptide sequence | VVTVGTVTDDQRLVEVPKLSIAALRFTRTARARIEKAGGECLTLDQLALRKPTGSNTLLLRGARNAREAVKHFGSGVNHAKPYVISKGKKEENARGRRRSRGFKI* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | 60S ribosomal protein L18-B from Schizosaccharomyces with 71.43% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAPB17E12.13) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003626232.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer