Protein coding transcript 97597

• Transcript: Ll_transcript_388395
• CDS coordinates: 179-532 (+)
• Peptide sequence: MELIHDMRGHMEQLYREISELRKSMETCMDMQMQMQFQQCKNQQVQLVKNEEKKSHNMGPKKGNCCICYDMKVDALLYRCGHMCTCLNCANELQWNSGKCPICRAKIVDVVRVYVDF*
• ORF Type: complete

Annotations of Ll_transcript_388395

• Blastp: Protein neuralized from Sophophora with 54.72% of identity
• Blastx: Protein neuralized from Sophophora with 53.7% of identity
• Eggnog: protein ubiquitination(ENOG410ZMNG)
• Kegg: Link to kegg annotations (Dmel_CG11988)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424862.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;