Transcript | Ll_transcript_388395 |
---|---|
CDS coordinates | 179-532 (+) |
Peptide sequence | MELIHDMRGHMEQLYREISELRKSMETCMDMQMQMQFQQCKNQQVQLVKNEEKKSHNMGPKKGNCCICYDMKVDALLYRCGHMCTCLNCANELQWNSGKCPICRAKIVDVVRVYVDF* |
ORF Type | complete |
Blastp | Protein neuralized from Sophophora with 54.72% of identity |
---|---|
Blastx | Protein neuralized from Sophophora with 53.7% of identity |
Eggnog | protein ubiquitination(ENOG410ZMNG) |
Kegg | Link to kegg annotations (Dmel_CG11988) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424862.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer