Protein coding transcript 976

• Transcript: Ll_transcript_513949
• CDS coordinates: 1-402 (+)
• Peptide sequence: FKKIGCHVLAASCDSQFSHLAWVNTPREEGGIGAMNIPILADKTGKIARDYNIYNEETGIPFRGLFIIDGKQNLRQITVNDLPVGRDVDEVLRLVQAFQYTDKHGEVCPAGWRPGKKTLTPNANGIKNYLKSN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_513949

• Blastp: Peroxiredoxin 1 from Sophophora with 67.67% of identity
• Blastx: Peroxiredoxin 1 from Sophophora with 67.67% of identity
• Eggnog: alkyl hydroperoxide reductase(COG0450)
• Kegg: Link to kegg annotations (Dmel_CG1633)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497675.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;