Protein coding transcript 97639

• Transcript: Ll_transcript_386265
• CDS coordinates: 132-1241 (+)
• Peptide sequence: MASIHSLLSQNQSSLLLSSHFLHHSTLSFFQHNINTHSFLPRVSLTNSNQSQPPLLYSKTEVSDVPLLSCSEAIERLKTFREGIKGKQQYLAMYSSIFGGITTDPAAMVIPMDDHMVHRGHGVFDTAAIIDGYLYELDQHLDRFLRSSSLSKIDPPFDRGSIRRILIQTVSASKCRKGSLRYWLSAGPGDFQLSPSGCHQSSLYAIVIPDLSPAPLNSRGVKVVTSSIPIKPPQFATAKSVNYLPNVLSKMEAEEAGAFAGIWLDSDGFVAEGPNMNVAFVTKQKELIMPHFDKILSGCTAKRVLTLAECLVKEGKLQGIRMRNVTVDEGKKADEMMLIGSGILIYPVVQWDEQVIGDGEYFYCFNIFT*
• ORF Type: complete

Annotations of Ll_transcript_386265

• Blastp: D-amino-acid transaminase, chloroplastic from Arabidopsis with 69.41% of identity
• Blastx: D-amino-acid transaminase, chloroplastic from Arabidopsis with 69.41% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT5G57850)
• CantataDB: Link to cantataDB annotations (CNT0001721)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457872.1)
• Pfam: Amino-transferase class IV (PF01063.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;