| Transcript | Ll_transcript_386270 |
|---|---|
| CDS coordinates | 1026-1370 (+) |
| Peptide sequence | MNFMRKSTDGFSIGSILLDFSGGIFNFSQMVVQSIDQGSWMNFCGNIGKVMISLVTIFYDSILMFQHYVLYPDNKGVITSKIYEEIKQPLNSATQIDEQINGSVKSSDLSSAEV* |
| ORF Type | complete |
| Blastp | Cystinosin homolog from Arabidopsis with 60% of identity |
|---|---|
| Blastx | Cystinosin homolog from Arabidopsis with 61.8% of identity |
| Eggnog | cystinosin(ENOG410XQSD) |
| Kegg | Link to kegg annotations (AT5G40670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427034.1) |
| Pfam | PQ loop repeat (PF04193.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer