Protein coding transcript 97653

• Transcript: Ll_transcript_387040
• CDS coordinates: 338-805 (+)
• Peptide sequence: MAPKRRLPFAKKRSKRSHFPVLFFVILCVLAAAVFFIGSDQGDTPAVPSKKVAKWREWQTLQDLKSLFSKEVLDVIVSSTNDMGPMSLDNFRKNNLSASWIVSGLETSNATYELSQPTMHARQEKPKAKEDKSSDGRAQWSDSPTQQARRVSIIL*
• ORF Type: complete

Annotations of Ll_transcript_387040

• Blastp: Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 38.97% of identity
• Blastx: Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 65.45% of identity
• Eggnog: Alpha-1,4-galacturonosyltransferase(ENOG4111FC1)
• Kegg: Link to kegg annotations (AT3G61130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456989.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;