Protein coding transcript 977

• Transcript: Ll_transcript_432077
• CDS coordinates: 2-385 (+)
• Peptide sequence: NCSICQQAKVENIMPVGLLQPLPIPQQILEDLAMDFITKLPSSNGFTTILVVVDRLSKFGHFIPLKSDFTSTVVAEAFIHHIVRIYGIPKSIVSDRDKVFFSSFWQHLFKAQGTTLAMSSTYHPQPDG
• ORF Type: internal

Annotations of Ll_transcript_432077

• Blastp: Transposon Tf2-8 polyprotein from Schizosaccharomyces with 38.28% of identity
• Blastx: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 38.28% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC13D1.01c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015965354.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;