Protein coding transcript 97713

• Transcript: Ll_transcript_388689
• CDS coordinates: 186-632 (+)
• Peptide sequence: MATNENLPPNVIKQLAKELKNLDESPPEGIKVVVNDDDFSTIFADIDGPAGTPYENGIFRMKLLLSHHFPHSPPKGFFLTKIFHPNIATNGEICVNTLKKDWNPTLGLRHVLIVVRCLLIEPFPESALNEQAGKLLLEDYDEYARHAR*
• ORF Type: complete

Annotations of Ll_transcript_388689

• Blastp: Ubiquitin-conjugating enzyme E2 22 from Arabidopsis with 87.16% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 22 from Arabidopsis with 87.16% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT5G05080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007161841.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;