Protein coding transcript 978

• Transcript: Ll_transcript_432098
• CDS coordinates: 2-364 (+)
• Peptide sequence: EDGEDRLKDFLDILLDVSEDKDCEVKMTRNHIKSLILDYFTAATDTTAISVEWTISELFNNPRVLKKAQEEVDRVTGRERLICEADSLNLTYIHAIIKETMRLHPPITMIMRKGIEDCVVN
• ORF Type: internal

Annotations of Ll_transcript_432098

• Blastp: Licodione synthase from Glycyrrhiza with 55.17% of identity
• Blastx: Licodione synthase from Glycyrrhiza with 55.17% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA22423)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448664.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;