Protein coding transcript 97818

• Transcript: Ll_transcript_387299
• CDS coordinates: 451-753 (+)
• Peptide sequence: MTNNLFFSLFLLLASTLSSPSLARVPFHTNAPSEDFKNISYATRARHLLEDNESQAQKIVDFARGYMTNDDLETAVKEFGQRCSNISRIYRLFLIHVLVS*
• ORF Type: complete

Annotations of Ll_transcript_387299

• Blastp: Carboxypeptidase SOL1 from Arabidopsis with 81.25% of identity
• Blastx: Carboxypeptidase SOL1 from Arabidopsis with 83.33% of identity
• Eggnog: carboxy-peptidase(ENOG410XX0H)
• Kegg: Link to kegg annotations (AT1G71696)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442044.1)
• Pfam: Zinc carboxypeptidase (PF00246.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;