Protein coding transcript 97820

• Transcript: Ll_transcript_387303
• CDS coordinates: 309-1016 (+)
• Peptide sequence: MNKNLLFYLLLLAFTLSSASSEDSKNISYAIRARHLLEDNLSQAQTIVDLAQGYMTNADLERAIKEFGQRCNTISRIYSIGKSVNGVPLWVIEISDKPGEEETEPAFKYIGNVHGDEPVGRELLIFLANWLCDNHLKDPLATLIVENVHLHILPSMNPDGFSLRRRGNANNIDLNRDFPDQFFPVNDDEDSRQPETRAIMNWLRDIRFTASATLHGVLLTWNSWCTSCKLSLGWY*
• ORF Type: complete

Annotations of Ll_transcript_387303

• Blastp: Carboxypeptidase SOL1 from Arabidopsis with 71.07% of identity
• Blastx: Carboxypeptidase SOL1 from Arabidopsis with 71.07% of identity
• Eggnog: carboxy-peptidase(ENOG410XX0H)
• Kegg: Link to kegg annotations (AT1G71696)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427261.1)
• Pfam: Zinc carboxypeptidase (PF00246.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;