Transcript | Ll_transcript_386883 |
---|---|
CDS coordinates | 3-902 (+) |
Peptide sequence | SVRDAMQTQWCSGMRFKMPFETEDSSRISWFMGTISSVRVVDPIRWPNSPWRLLQVVWDEPDLLQNVKCVNPWLVELVSNIPNFNLSPFSPPRKKPRFPQTPDFHHINQLPMPSFYNNHLNHNNSVCNSRDNSSAGIQGARHAQFGLTPSDFPFNKPQTDALFPGALPWLNRSAQSIRPPRDAYKTENNVDISCLLTIGNPGQSLKERVKAKSPHILLFGQLIQTEQHNSNIISAGTNGNSSTKATLRKTSNASDGLNSDLLQNSPMEKSSSDEGSPRYKDQHKSDLRTENVNQLCLAM* |
ORF Type | 5prime_partial |
Blastp | Auxin response factor 22 from Oryza sativa with 54.21% of identity |
---|---|
Blastx | Auxin response factor 22 from Oryza sativa with 54.21% of identity |
Eggnog | auxin response factor(ENOG410ZZ2C) |
Kegg | Link to kegg annotations (4348918) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449806.1) |
Pfam | Auxin response factor (PF06507.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer