Protein coding transcript 97929

• Transcript: Ll_transcript_387911
• CDS coordinates: 159-473 (+)
• Peptide sequence: MALPKAKEIVSSNLVVVFSKTYCPYCVQVKKLFTQLNVTYKAIELDSESDGKEIQAALAEWTGQRTVPNVFIGGNHIGGCDSITGLHGQGKLVPLLNEAGVKTA*
• ORF Type: complete

Annotations of Ll_transcript_387911

• Blastp: Glutaredoxin from Ricinus with 76% of identity
• Blastx: Glutaredoxin from Ricinus with 76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8289824)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454824.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;