Transcript | Ll_transcript_388073 |
---|---|
CDS coordinates | 1-582 (+) |
Peptide sequence | QTVHIEKLSDTQCQPESQLKFITEAWLQIVECRRVLKWTYAYGYYLPENEHAKKQFFEYLQGEAESGLERLHQCAEKELHPFINDGGPSREFNDFRTKLAGLTSVTKNYFENLVRALENGLSDVDADGATSSKATSSKNAAGSSKGRGGRGKGTLRSSLSNRMSDDSHWFCEQCTYANVKSATACQICNHQRR* |
ORF Type | 5prime_partial |
Blastp | Probable E3 ubiquitin-protein ligase ARI8 from Arabidopsis with 67.19% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase ARI8 from Arabidopsis with 66.15% of identity |
Eggnog | RING finger) protein(ENOG410XP9Y) |
Kegg | Link to kegg annotations (AT1G65430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448565.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer