Protein coding transcript 97991

• Transcript: Ll_transcript_387197
• CDS coordinates: 1414-1956 (+)
• Peptide sequence: MMDLHQGALMLLGPTMNPKIAFELSERIPHLALRMKEHCHRALVFAKRLKNLGLKVIYPGLEDHPQHELLMSMANKDYGYGGILCVDMETEERANWLMNHLQNYGQFGLMAVSLGYYETLMSCSGSSTSSEMNSEEKELAGISPGLIRMSIGYIGTLEQKWTQLEKALTKLKEHDLSHKN*
• ORF Type: complete

Annotations of Ll_transcript_387197

• Blastp: Methionine gamma-lyase from Arabidopsis with 73.1% of identity
• Blastx: Methionine gamma-lyase from Arabidopsis with 70.59% of identity
• Eggnog: cystathionine(COG0626)
• Kegg: Link to kegg annotations (AT1G64660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428651.1)
• Pfam: Cys/Met metabolism PLP-dependent enzyme (PF01053.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;