Transcript | Ll_transcript_388833 |
---|---|
CDS coordinates | 345-971 (+) |
Peptide sequence | MEWNSKSLGQWDWEENLFFFNGKASENTKLQSTTNWSSEADQEINVGLFYPSRGSRCSESELMHASSSRSSKSASINSSTNEDTKLSMFTLEASQDDDSTGKKELSKEEPVETSPAPEPSSASGEPLLTLKLGKRLYFEDVCAGSDSKRPSSSTGKKCKSNGQNLQHPSCQVEGCGLDLSSAKDYHRKHRVCENHSKFPKVIIAGSERR |
ORF Type | 3prime_partial |
Blastp | Squamosa promoter-binding-like protein 3 from Oryza sativa with 42.27% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 3 from Oryza sativa with 39.45% of identity |
Eggnog | Squamosa promoter-binding-like protein(ENOG410YKP9) |
Kegg | Link to kegg annotations (9270639) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438295.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer