Protein coding transcript 98034

• Transcript: Ll_transcript_388800
• CDS coordinates: 345-1127 (+)
• Peptide sequence: MEWNSKSLGQWDWEENLFFFNGKASENTKLQSTTNWSSEADQEINVGLFYPSRGSRCSESELMHASSSRSSKSASINSSTNEDTKLSMFTLEASQDDDSTGKKELSKEELVETSPAPEPSSASGEQLLTLKLGKRLYLEDVSTGSDSKKPSSSAGKKCKSNGQNLQHPSCQVEGCGLDLSSAKGYHRKHRVCENHSKSPKVVIAGSERRFCQQCSRFHGLSEFDDKKRSCRRRLSDHNARRRKPHADAVRLNTLALSSSPY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_388800

• Blastp: Squamosa promoter-binding-like protein 3 from Oryza sativa with 46.92% of identity
• Blastx: Squamosa promoter-binding-like protein 2 from Arabidopsis with 85.37% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YKP9)
• Kegg: Link to kegg annotations (9270639)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417930.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;