Protein coding transcript 98073

• Transcript: Ll_transcript_389036
• CDS coordinates: 1006-1383 (+)
• Peptide sequence: MTADDAIGTNGVPPWNWRETPGSGEEGQSPCGRVISVKWGDYTRRIGIDGGAEAIEEAIRAAFRLRTKRAFWLEDEDRVIRSIDRDMPLGSYTLHIDEDSNVREFQSKAKLSHSVPPPPVTFFET*
• ORF Type: complete

Annotations of Ll_transcript_389036

• Blastp: Trihelix transcription factor GT-4 from Arabidopsis with 72.28% of identity
• Blastx: Trihelix transcription factor GT-1 from Arabidopsis with 59.33% of identity
• Eggnog: Transcription factor(ENOG410YYXY)
• Kegg: Link to kegg annotations (AT3G25990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417471.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;