Protein coding transcript 98077

• Transcript: Ll_transcript_389044
• CDS coordinates: 113-814 (+)
• Peptide sequence: MYSLEKPRPIDFYKEEEESPDMMIEVVPTTDNNNHHHLQQPPPPPPLILTESSGEDPELDQMKAPKKRAETWVQDETRNLISLRREMDALFNTSKSNKHLWEQISAKMRDKGFDRSPTMCTDKWRNLLKEFKKAKHQDNRGSSKMSYYKEIDEILRERSCKTLHYKTPTPPTLSKVDSFMHFADKGIEDASISFGPVEGMCHCNILQLLGYYVLVLFIMFTCFLYYNIWFTTR*
• ORF Type: complete

Annotations of Ll_transcript_389044

• Blastp: Trihelix transcription factor GT-1 from Arabidopsis with 61.71% of identity
• Blastx: Trihelix transcription factor GT-4 from Arabidopsis with 75.14% of identity
• Eggnog: DNA binding protein GT-1(ENOG410XUBM)
• Kegg: Link to kegg annotations (AT1G13450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417472.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;