Protein coding transcript 98105

• Transcript: Ll_transcript_387142
• CDS coordinates: 1647-2579 (+)
• Peptide sequence: MLLYSLWSNVIFILFAYYLYMCFISGDFMDKTPSGTVQILTRSYQANNPQFSEPLRSDAMNTDAMIRPDDSEIGEEDQDEQSSLNPLDKFLPPPPTAKCTEDLQKKINKFLDLKKTGRSFNGEVRNRKNYRNPDFLLHAVSYQDIDQIGSCFSKDVFDPHGCDPSDFYDEIEADLRRGSDRKEQEKKKEQKVEYIPGGTQPGIVAGALRISLPVAGGSAVAASGLHLVAPTTDSINRDGRQNKKSKWDNVDDDGKNPLPSVGQDSVSTIGANATILSAANAGGGYMLFAQQKRLEAEEQRCSERRLERRL*
• ORF Type: complete

Annotations of Ll_transcript_387142

• Blastp: SAP30-binding protein from Homo with 30.7% of identity
• Blastx: SAP30-binding protein from Mus with 30.15% of identity
• Eggnog: SAP30 binding protein(ENOG4111K05)
• Kegg: Link to kegg annotations (29115)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439622.1)
• Pfam: HCNGP-like protein (PF07818.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;