Transcript | Ll_transcript_387130 |
---|---|
CDS coordinates | 1518-2210 (+) |
Peptide sequence | MDKTPSGTVQILTRSYQANNPQFSEPLRSDAMNTDAMIRPDDSEIGEEDQDEQSSLNPLDKFLPPPPTAKCTEDLQKKINKFLDLKKTGRSFNGEVRNRKNYRNPDFLLHAVSYQDIDQIGSCFSKDVFDPHGCDPSDFYDEIEADLRRGSDRKEQEKKKEQKVEYIPGGTQPGIVAGALRISLPVAGGSAVAASGLHLVAPTTDSINRDGRQNKKSKWDNVNIRLIKCN* |
ORF Type | complete |
Blastp | SAP30-binding protein from Homo with 30.97% of identity |
---|---|
Blastx | SAP30-binding protein from Homo with 30.97% of identity |
Eggnog | SAP30 binding protein(ENOG4111K05) |
Kegg | Link to kegg annotations (29115) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439620.1) |
Pfam | HCNGP-like protein (PF07818.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer