Protein coding transcript 98131

• Transcript: Ll_transcript_388577
• CDS coordinates: 3-635 (+)
• Peptide sequence: PPHTNAPPPPPPPPFGRAPPPPPPPPYSSAPPPPPPPPFGRAPPSPPPPPQSSRAPPPPPPPAHGAPPPPPMHGAPPPPPLPGGRGPPPPPLPGGRGPPPPPPPGGRGPPPPPPPGGRGPPPPPPPGAPGAPPPPRLPGGAPPPPPPKGANVGADPRGRGRGGYARPGGPGAMTAPKRSSLKPLHWSKVTRALQGSLWEELQRHGEPQIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_388577

• Blastp: Formin-like protein 20 from Arabidopsis with 71.93% of identity
• Blastx: Formin-like protein 20 from Arabidopsis with 71.9% of identity
• Eggnog: FH2(ENOG41100UH)
• Kegg: Link to kegg annotations (AT5G07740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438455.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;