Protein coding transcript 98137

• Transcript: Ll_transcript_388583
• CDS coordinates: 3-1064 (+)
• Peptide sequence: PPHTNAPPPPPPPPFGRAPPPPPPPPYSSAPPPPPPPPFGRAPPSPPPPPQSSRAPPPPPPPAHGAPPPPPMHGAPPPPPLPGGRGPPPPPLPGGRGPPPPPPPGGRGPPPPPPPGGRGPPPPPPPGAPGAPPPPRLPGGAPPPPPPKGANVGADPRGRGRGGYARPGGPGAMTAPKRSSLKPLHWSKVTRALQGSLWEELQRHGEPQTASEFDVSELEKLFSANVSKTADSKTGGRRKSVGSKTDIVHLIDLRRANNTEIMLTKVKMPLPDMMAAVLAMNESVLDVDQVDNLIKFCPTKEEMELLKGYTGDRANLGKCEQYFLEMMNVPRVESKLRIFSFKIQFGSQVWWCQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_388583

• Blastp: Formin-like protein 20 from Arabidopsis with 77.34% of identity
• Blastx: Formin-like protein 20 from Arabidopsis with 81.14% of identity
• Eggnog: FH2(ENOG41100UH)
• Kegg: Link to kegg annotations (AT5G07740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463427.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;