Protein coding transcript 98177

• Transcript: Ll_transcript_387556
• CDS coordinates: 1343-2137 (+)
• Peptide sequence: MILSGEARRPRQVVKVLNSDGKVIAYAKPRYPMVKGSDTSTTESGSEAEDIASPKAVHNYSHLRLTPVREEAKVVGKSSYAASGSLSGYDEYVPMVDKAVDAVWKKQASLQRSHTSKGTPPLLDTPKIPEGIRARIWVALTVFVLTLFTLFRSFTSRVTKMPPAISSNDCPGPSESSSDATNKEDRHPPSPTPAHTEENSLSSMMKRLNELEEKVDTLQSKPSEMPNEKAELLNAAVCRVDALEAELIATKKALYEALMRQEELL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_387556

• Blastp: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 60.44% of identity
• Blastx: Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 from Arabidopsis with 65.95% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT2G21520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413568.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;