Protein coding transcript 98251

• Transcript: Ll_transcript_527893
• CDS coordinates: 347-655 (+)
• Peptide sequence: MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSASMLKTLERYQKCNYGAPEPNVSTREALVMELSSQQEYLKLKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_527893

• Blastp: Developmental protein SEPALLATA 3 from Arabidopsis with 94.12% of identity
• Blastx: Developmental protein SEPALLATA 3 from Arabidopsis with 94.12% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT1G24260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434306.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;