Protein coding transcript 98253

• Transcript: Ll_transcript_527901
• CDS coordinates: 2660-3040 (+)
• Peptide sequence: MLKTLERYQKCSYGAVEVNKPSKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQLDSSLKHVRSTKTQFMLDQLSDLQNKEQMLVETNRGLAMKVTLYTKKISNLATLASL*
• ORF Type: complete

Annotations of Ll_transcript_527901

• Blastp: Developmental protein SEPALLATA 1 from Arabidopsis with 81.98% of identity
• Blastx: Developmental protein SEPALLATA 1 from Arabidopsis with 75.83% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G15800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426557.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;