Protein coding transcript 983

• Transcript: Ll_transcript_432096
• CDS coordinates: 2-391 (+)
• Peptide sequence: VGGYYDAGDNVKFGLPMAYTVTMLAWGAIEFRKEITDLDQMGHTLWAIRWGTDYFIKAHSQFNVLWGQVGDGASDHYCWERAEDMTTSRTAYKIDEEHPGSDLAGETAAALAAASIAFSPYNSSYSALY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_432096

• Blastp: Endoglucanase 5 from Arabidopsis with 79.53% of identity
• Blastx: Endoglucanase 5 from Arabidopsis with 79.53% of identity
• Eggnog: hydrolase family(ENOG410XPC9)
• Kegg: Link to kegg annotations (AT1G48930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020973731.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;