Protein coding transcript 984

• Transcript: Ll_transcript_432097
• CDS coordinates: 2-649 (+)
• Peptide sequence: VGGYYDAGDNVKFGLPMAYTVTMLAWGAIEFRKEITDLDQMGHTLWAIRWGTDYFIKAHSQFNVLWGQVGDGASDHYCWERAEDMTTSRTAYKIDEEHPGSDLAGETAAALAAASIAFKPYNSSYSSLLLVHAKQLFTFADKFRGLYDEYVFGADKFYSSSGYSDELLWAAAWLFHATDDEYYLNYVVDNAVYMGGTGWAVREFSWDNKYAGVQIL
• ORF Type: internal

Annotations of Ll_transcript_432097

• Blastp: Endoglucanase 5 from Arabidopsis with 76.74% of identity
• Blastx: Endoglucanase 5 from Arabidopsis with 76.74% of identity
• Eggnog: hydrolase family(ENOG410XPC9)
• Kegg: Link to kegg annotations (AT1G48930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441110.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;