Transcript | Ll_transcript_528359 |
---|---|
CDS coordinates | 2-376 (+) |
Peptide sequence | NDCTKLVKVHYSVGLHKKLEVMSFHRCISLESFPSKMEMCSLKYLNLNYCSKLRRLPDFDDKMECFSELHSKNCTNLLSLPNSISNLKSLKILNISGCSKVDRLPNNINENKALEELDMSYTSL* |
ORF Type | 5prime_partial |
Blastp | Probable disease resistance protein RPP1 from Arabidopsis with 40.78% of identity |
---|---|
Blastx | Probable disease resistance protein RPP1 from Arabidopsis with 40.78% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT3G44480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441909.1) |
Pfam | Leucine rich repeats (6 copies) (PF13306.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer