Protein coding transcript 98401

• Transcript: Ll_transcript_528360
• CDS coordinates: 2-526 (+)
• Peptide sequence: LNYCSKLRRLPDFDGKMECVSEMYLRNCTNLLSLPNTISNLKSLKIINIFGCSKVDRLPKNINENKALEELDMSYTSIREMDSSLFHLENLKRLSFQGCSGPSYKPQCKLLTPLWNCWREIYQIINTESLILPRSISNLSSLTSLDLRYCKLKSLPEDIGHLPSLELLDLRGNVD
• ORF Type: internal

Annotations of Ll_transcript_528360

• Blastp: Probable disease resistance protein RPP1 from Arabidopsis with 36.42% of identity
• Blastx: Probable disease resistance protein RPP1 from Arabidopsis with 36.42% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G44480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;