Protein coding transcript 98402

• Transcript: Ll_transcript_528361
• CDS coordinates: 188-1405 (+)
• Peptide sequence: MECFSELYLEYCTNLLSLPNTISNLKSLKILDICGCSKVDRLPNNINENKALEDLDMNYTSIREIDSSLFHLENLKRLIFDGCSGPTFKSQGKLLTSLWKGWRKRYQIINTESLMLPRFISNLSSLTILDLRFCNLKSLPEDIGHLPSLEILDLRGNVGLSLHLASIANLSKLRILLFDGNMYGSRTLLPTHVRIYPQDLSADLSVVNGPKLWNSFKSCCNEEEHIEDCSPFLLFLTSSMSINKNYPSYYIDGPVLSRHDNSSAYIETDCGMGIWFGLVLFIVLEPEVSLSMPLMTNSIYITWTFESLDEDARIFCYITSTTANSNHYVMTIIMNDDVAYVQRHQSGYHHKNESKHFINFWETVENSQLKIEVALKGRKIRKCWLQQLGKEDFRFESLTIPSTNL*
• ORF Type: complete

Annotations of Ll_transcript_528361

• Blastp: TMV resistance protein N from Nicotiana with 34.48% of identity
• Blastx: TMV resistance protein N from Nicotiana with 31.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;