Transcript | Ll_transcript_528352 |
---|---|
CDS coordinates | 2-376 (+) |
Peptide sequence | NDCTKLVKVHYSVGLHKKLEVMIFCRCISLESFPSKMEMCSLKYLTLNYCSKLRRLPDFDDKMECFSELHSKNCTNLLSLPNSISNLKSLKILNISGCSKVDRLPNNINENKALEELDMSYTSL* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | Probable disease resistance protein RPP1 from Arabidopsis with 40.78% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013461109.1) |
Pfam | Leucine rich repeat (PF13855.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer