Protein coding transcript 98409

• Transcript: Ll_transcript_528354
• CDS coordinates: 2-685 (+)
• Peptide sequence: NDCTKLVKVHYSVGLHKKLEVMIFCRCISLESFPSKMEMCSLKYLTLNYCSKLRRLPDFDDKMECFSELHLENCTNLLSLPNTISNLKSLKIINIFGCSKVDRLPNNINENKALEELDMSYTSIREMDSSLFHLENLKRLIFDGCSGPTFKSQGKLLTSLWKGWRKRYQIINTESLMLPRFISNLSSLTILALRDCNLKSLPEDIGHLPSLEKLDLCGNVDLSLHLAS
• ORF Type: internal

Annotations of Ll_transcript_528354

• Blastp: TMV resistance protein N from Nicotiana with 31.28% of identity
• Blastx: TMV resistance protein N from Nicotiana with 31.28% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;