Protein coding transcript 98410

• Transcript: Ll_transcript_528355
• CDS coordinates: 2-376 (+)
• Peptide sequence: NDCTKLVKVHYSVGLHKKLEKMNFYGCISLESFPSKMEMCSLKDLNLNYCSKLRRLPDFDDKMECFSELHSKNCTNLLSLPNSISNLKSLKILNISGCSKVDRLPNNINENKALEELDMSYTSL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_528355

• Blastp: Disease resistance-like protein CSA1 from Arabidopsis with 38.14% of identity
• Blastx: Probable disease resistance protein RPP1 from Arabidopsis with 40.78% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G17880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013461108.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;