Protein coding transcript 98454

• Transcript: Ll_transcript_528775
• CDS coordinates: 132-632 (+)
• Peptide sequence: MNALESLAVGTSEENEVVTGLVQQLKLEQNKFEEKKKHEYQEYSQLKKEKALNEIEISALKQELEMAKRMHGGQVLQLELQANESKAEYEKKIQELEWHLANARKQVKDLEAFSESRYFNWKNKEHTYQSFLNSQHRAIQKLRAGMKSIKNEVIKTKRSYMEEFKYF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_528775

• Blastp: Kinesin-like protein KIN-14J from Arabidopsis with 40.72% of identity
• Blastx: Kinesin-like protein KIN-14J from Arabidopsis with 42.86% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT1G63640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424122.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;