Protein coding transcript 98533

• Transcript: Ll_transcript_530281
• CDS coordinates: 132-926 (+)
• Peptide sequence: MASNSQKEKDSPADVKVGAADKKNTKDETPSADPSTGQRATSAPSTGFPSNPFDFSAMSGLLDDPSIKELAEQIAQDPSFTQMAEQLQKTFQGTTQEGIPNFDNQQYFQTMQQVMQNPDFMTMAERLGSALMQDPSMSTMLESFTNPSNKEQLEERMARIKEDPSLKHILDEIETGGPTAMMRYWNDEEVLGKLGQAMGLANAGDAAASVENSVPDETDDAGNEDESIVHHTASTGDIEVCHITFCADAYAFKAFFLLRNLSYG*
• ORF Type: complete

Annotations of Ll_transcript_530281

• Blastp: Ankyrin repeat domain-containing protein 2B from Arabidopsis with 55.33% of identity
• Blastx: Ankyrin repeat domain-containing protein 2B from Arabidopsis with 55.33% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G17390)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440907.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;