Protein coding transcript 98536

• Transcript: Ll_transcript_530292
• CDS coordinates: 163-528 (+)
• Peptide sequence: MGLATSGGAAASAENSVPEETDDDVGNEDESIVHHTASTGDVEGLKSALASGADKDEEDSEGRTALHFSCGYGEVKCAKVLIEGGAKVDGLDKNKNTALHYAAGYGRKECVALLLENGAAVT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_530292

• Blastp: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 82.61% of identity
• Blastx: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 65.97% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT4G35450)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419674.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;