Protein coding transcript 98560

• Transcript: Ll_transcript_530317
• CDS coordinates: 89-826 (+)
• Peptide sequence: MASNPPKDSPADDKVGTGENKNAKAETSSATATGFPPNPFDFSAMSGLLNDPSIKELAEQIAKDPSFNQMAEQLQKTFQGATPDSIPNFDNQQYLQTMQQVMQNPNFMTMAERLGNALVQDPSMSAMLESFTNPSNKEQIEERMARIKEDPSLKHILEEIETGGPSAMMRYWNDEEVLGKLGQAMGLANAGDAAASVENSVPDETDDAGNEDESIVHHTASTGDIEGLKSALAAGADKDEEDSEGR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_530317

• Blastp: Ankyrin repeat domain-containing protein 2B from Arabidopsis with 59.44% of identity
• Blastx: Ankyrin repeat domain-containing protein 2B from Arabidopsis with 59.44% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G17390)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440909.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;