Protein coding transcript 98588

• Transcript: Ll_transcript_527946
• CDS coordinates: 1824-2132 (+)
• Peptide sequence: MAEVYKNGPVEVGFTVYEDFAHYKSGVYKHITGFALGGHAVKLIGWGTSDDGDDYWLLANQWNRSWGDDGYFKIKRGTNECGIEDDGYFKIKRGTNECGIEDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_527946

• Blastp: Cathepsin B-like protease 2 from Arabidopsis with 92.86% of identity
• Blastx: Cathepsin B-like protease 2 from Arabidopsis with 76.36% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT1G02305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419019.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;