Transcript | Ll_transcript_527941 |
---|---|
CDS coordinates | 690-1265 (+) |
Peptide sequence | MGCDGGEPLYAWRYLSHHGVVSEECDPYFDQIGCAHPGCEPSYPTPKCVKKCVSGNQLWRKSKHYSVRAYKVKSNPYDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKHITGVALGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYFKIKRGTNECGIEADITAGLPSSKNLIREVTDMDANSDVSF* |
ORF Type | complete |
Blastp | Cathepsin B-like protease 2 from Arabidopsis with 79.89% of identity |
---|---|
Blastx | Cathepsin B-like protease 2 from Arabidopsis with 80.95% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (AT1G02305) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422386.1) |
Pfam | Papain family cysteine protease (PF00112.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer