| Transcript | Ll_transcript_444208 |
|---|---|
| CDS coordinates | 3-335 (+) |
| Peptide sequence | SALAWARDTNLYVCSSVFPESIEAVSKTDLGGSYFDQAAETVQLQIAKGGYRLANWLDQLALAAGQKNATTTYKRSAEVDLSGSSLLPAPREMSLAKLARRDFGGCDHPH* |
| ORF Type | 5prime_partial |
| Blastp | Nuclease P1 from Penicillium with 46.67% of identity |
|---|---|
| Blastx | Nuclease PA3 from Penicillium with 46.67% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017441120.1) |
| Pfam | S1/P1 Nuclease (PF02265.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer