Transcript | Ll_transcript_529210 |
---|---|
CDS coordinates | 2441-3049 (+) |
Peptide sequence | MSNAALHTIARNRPNMTRFRLCIIEPRTPDYLTLQPLDSGFGAIVEHCKDLQRLSLSGLLTDRVFEYIGTYAKKLEMLSVAFAGESDLGLHHVLSGCDNLRKLEIRDCPFGDKALLANAAKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPDSRPDTCPVEKLYIYRTIAGPRSDMPGFVWTMKDDSSPRLE* |
ORF Type | complete |
Blastp | Protein TRANSPORT INHIBITOR RESPONSE 1 from Arabidopsis with 85.57% of identity |
---|---|
Blastx | Protein TRANSPORT INHIBITOR RESPONSE 1 from Arabidopsis with 85.23% of identity |
Eggnog | F-box and leucine-rich repeat protein(ENOG410XQ54) |
Kegg | Link to kegg annotations (AT3G62980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421520.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer