Protein coding transcript 98677

• Transcript: Ll_transcript_528606
• CDS coordinates: 161-913 (+)
• Peptide sequence: MPETGVKSTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSIHFPQIFPDSSKKIQFADVGCGFGGLLISLATLFPETLMVGMELRDKVSEYVKERILSLRVANPGQYQNASVVRTNSMKYIPNYFEKGQLSKMFFLFPDPHFKEKNHRRRVISPFLLDEYAYVLGVGGIIYTITDVEELGDWMKSCLENHPLFEALTEKELEADPVVKLLSSATEEGQKVARNEGQTFQAVYRRIVPTEQTS*
• ORF Type: complete

Annotations of Ll_transcript_528606

• Blastp: tRNA (guanine-N(7)-)-methyltransferase from Arabidopsis with 80.91% of identity
• Blastx: tRNA (guanine-N(7)-)-methyltransferase from Arabidopsis with 80.91% of identity
• Eggnog: Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (By similarity)(COG0220)
• Kegg: Link to kegg annotations (AT5G24840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415616.1)
• Pfam: Putative methyltransferase (PF02390.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;