Transcript | Ll_transcript_528606 |
---|---|
CDS coordinates | 161-913 (+) |
Peptide sequence | MPETGVKSTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSIHFPQIFPDSSKKIQFADVGCGFGGLLISLATLFPETLMVGMELRDKVSEYVKERILSLRVANPGQYQNASVVRTNSMKYIPNYFEKGQLSKMFFLFPDPHFKEKNHRRRVISPFLLDEYAYVLGVGGIIYTITDVEELGDWMKSCLENHPLFEALTEKELEADPVVKLLSSATEEGQKVARNEGQTFQAVYRRIVPTEQTS* |
ORF Type | complete |
Blastp | tRNA (guanine-N(7)-)-methyltransferase from Arabidopsis with 80.91% of identity |
---|---|
Blastx | tRNA (guanine-N(7)-)-methyltransferase from Arabidopsis with 80.91% of identity |
Eggnog | Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (By similarity)(COG0220) |
Kegg | Link to kegg annotations (AT5G24840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415616.1) |
Pfam | Putative methyltransferase (PF02390.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer