Protein coding transcript 98742

• Transcript: Ll_transcript_528490
• CDS coordinates: 1981-2325 (+)
• Peptide sequence: MTTYSYMEEIGIDGCNTGMISLQLLEAIKGNDKLIPHVVKLWVERYEMEPKPAMDELLTMLFQACGAKDYNKGDLVDENDVDDVVVALVNYAITVCISFPFGLFPICHPLLKNC*
• ORF Type: complete

Annotations of Ll_transcript_528490

• Blastp: Sister-chromatid cohesion protein 3 from Arabidopsis with 65.22% of identity
• Blastx: Sister-chromatid cohesion protein 3 from Arabidopsis with 64.44% of identity
• Eggnog: Stromal antigen(COG5537)
• Kegg: Link to kegg annotations (AT2G47980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444130.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;