Transcript | Ll_transcript_529385 |
---|---|
CDS coordinates | 184-1119 (+) |
Peptide sequence | MRTEFCESAHKMAQIPFTLLTFILICTLSIPNLVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTMGDYRVVTELEVYAVSIVGPFPTAVTSLLDLTRLDLHNNKLTGPIPSQIGRLKHLKILNLRWNKLQDAIPPEIGELRSLTHLYLSFNSFKGEIPRELANLPDLRYLYLHENRLTGRIPPEFGTLNNLRHLDVGNNHLVGTIRELIHIEGCFPALRNLYLNNNYFTGGIPAKLANLSSLEILYLSYNKMSSVIPSGVAHIPKLTYLYLDHNQFSGTIPVPFYKHPFLKEM* |
ORF Type | complete |
Blastp | Probable leucine-rich repeat receptor-like protein kinase At1g35710 from Arabidopsis with 41.07% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like protein kinase At1g35710 from Arabidopsis with 41.07% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT1G35710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429648.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer