Protein coding transcript 98771

• Transcript: Ll_transcript_529390
• CDS coordinates: 184-1206 (+)
• Peptide sequence: MRTEFCESAHKMAQIPFTLLTFILICTLSIPNLVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTMGDYRVVTELEVYAVSIVGPFPTAVTSLLDLTRLDLHNNKLTGPIPSQIGRLKHLKILNLRWNKLQDAIPPEIGELRSLTHLYLSFNSFKGEIPRELANLPDLRYLYLHENRLTGRIPPEFGTLNNLRHLDVGNNHLVGTIRELIHIEGCFPALRNLYLNNNYFTGGIPAKLANLSSLEILYLSYNKMSSVIPSGVAHIPKLTYLYLDHNQFSGTIPVPFYKHPFLKEMYIEGNAFGPGVKPIGFHKMLEVSDSDFLV*
• ORF Type: complete

Annotations of Ll_transcript_529390

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At1g35710 from Arabidopsis with 41.07% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At1g35710 from Arabidopsis with 41.07% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G35710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429648.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;