Protein coding transcript 98894

• Transcript: Ll_transcript_529195
• CDS coordinates: 138-560 (+)
• Peptide sequence: MYSYRCVSMFTSDHTLKVWSMDGLSDNMTVPINLKAKAVVAAHDKDINSVAVAPNDSLVCSGSQDRTACVWRLPDLVSVVVFKGHKRGIWSVEFSPVDQCVITASGDKTIRIWAISDGSCLKTFEGHTSSVLRALFVTRGT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_529195

• Blastp: Transducin beta-like protein 3 from Homo with 54.41% of identity
• Blastx: Transducin beta-like protein 3 from Homo with 54.41% of identity
• Eggnog: transducin beta-like 3(ENOG410XPQD)
• Kegg: Link to kegg annotations (10607)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014628780.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;